SCO1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytochrome c oxidase), enable subunits 1 and 2 to be incorporated into the holoprotein. This gene is the human homolog to the yeast SCO1 gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SCO1

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: PGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SCO1 homolog, mitochondrial

Protein Size: 301

Purification: Affinity Purified

• SKU: AVIARP56593_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56593_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 6341
• Host: Rabbit