SCP2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SCP2

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: SSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Non-specific lipid-transfer protein Ensembl ENSP00000360564

Protein Size: 503

Purification: Affinity Purified

• SKU: AVIARP56537_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56537_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 6342
• Host: Rabbit