SCRN2 Antibody - N-terminal region : FITC

SCRN2 Antibody - N-terminal region : FITC
SKU
AVIARP58525_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of SCRN2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCRN2

Key Reference: Way,G., (2002) Mol. Biol. Cell 13 (9), 3344-3354

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Secernin-2

Protein Size: 425

Purification: Affinity Purified
More Information
SKU AVIARP58525_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58525_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 90507
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×