SDCBP2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: SDCBP2 contains 2 PDZ (DHR) domains. The function of SDCBP2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SDCBP2

Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Syntenin-2

Protein Size: 207

Purification: Affinity Purified

• SKU: AVIARP55326_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55326_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 27111
• Host: Rabbit