SENP1 Antibody - middle region : HRP

SENP1 Antibody - middle region : HRP
SKU
AVIARP55082_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The covalent modification of proteins by the small ubiquitin-like protein SUMO is implicated in the regulation of nucleocytoplasmic transport, genomic stability, gene transcription, and other processes. Sumoylation is catalyzed on target lysine residues by a multienzyme process and is reversed by desumoylating enzymes such as SENP1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SENP1

Key Reference: Ohbayashi,N., (2008) Biochem. Biophys. Res. Commun. 371 (4), 823-828

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: PQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sentrin-specific protease 1

Protein Size: 643

Purification: Affinity Purified
More Information
SKU AVIARP55082_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55082_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29843
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×