SENP2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SUMO1 (UBL1; MIM 601912) is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-containing species.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SENP2

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sentrin-specific protease 2

Protein Size: 589

Purification: Affinity Purified

• SKU: AVIARP57548_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57548_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 59343
• Host: Rabbit