SENP2 Antibody - middle region : HRP

SENP2 Antibody - middle region : HRP
SKU
AVIARP57548_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SUMO1 (UBL1; MIM 601912) is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-containing species.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SENP2

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sentrin-specific protease 2

Protein Size: 589

Purification: Affinity Purified
More Information
SKU AVIARP57548_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57548_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 59343
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×