SEPT11 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT11(septin 11)

Key Reference: Xin,X., (2007) J. Histochem. Cytochem. 55 (11), 1089-1094

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Septin-11

Protein Size: 429

Purification: Affinity Purified

• SKU: AVIARP57173_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57173_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 55752
• Host: Rabbit