SERHL2 Antibody - C-terminal region : Biotin

SERHL2 Antibody - C-terminal region : Biotin
SKU
AVIARP58657_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEHL2

Key Reference: N/A

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: LLQRLLKSNSHLSEECGELLLQRGTTKVATGLVLNRDQRLAWAENSIDFI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: serine hydrolase-like protein 2

Protein Size: 314

Purification: Affinity purified
More Information
SKU AVIARP58657_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58657_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit
Clonality Polyclonal
Application Western Blotting
Human Gene ID 253190
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×