SERINC2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERINC2

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: SSIPEQKCNPHLPTQLGNETVVAGPEGYETQWWDAPSIVGLIIFLLCTLF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine incorporator 2

Protein Size: 455

Purification: Affinity Purified

• SKU: AVIARP55790_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55790_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 347735
• Host: Rabbit