SERPINB13 Antibody - middle region : Biotin

SERPINB13 Antibody - middle region : Biotin
SKU
AVIARP59171_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SERPINB13 may play a role in the proliferation or differentiation of keratinocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINB13

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: MVYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serpin B13

Protein Size: 391

Purification: Affinity Purified
More Information
SKU AVIARP59171_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59171_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5275
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×