SERPINB13 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: SERPINB13 may play a role in the proliferation or differentiation of keratinocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINB13

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: MVYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serpin B13

Protein Size: 391

Purification: Affinity Purified

• SKU: AVIARP59171_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59171_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5275
• Host: Rabbit
• Conjugate: Conjugated, Biotin