SERPINB2 Antibody - middle region : Biotin

SERPINB2 Antibody - middle region : Biotin
SKU
AVIARP56375_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SERPINB2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINB2

Key Reference: Croucher,D.R., (2007) Biochem. J. 408 (2), 203-210

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Plasminogen activator inhibitor 2

Protein Size: 415

Purification: Affinity Purified
More Information
SKU AVIARP56375_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56375_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5055
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×