SERPINB2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SERPINB2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINB2

Key Reference: Croucher,D.R., (2007) Biochem. J. 408 (2), 203-210

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Plasminogen activator inhibitor 2

Protein Size: 415

Purification: Affinity Purified

• SKU: AVIARP56375_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56375_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5055
• Host: Rabbit