SERPINB9 Antibody - C-terminal region : FITC

SERPINB9 Antibody - C-terminal region : FITC
SKU
AVIARP59175_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SPB9

Molecular Weight: 41 kDa

Peptide Sequence: Synthetic peptide located within the following region: LTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: serpin B9

Protein Size: 376

Purification: Affinity purified
More Information
SKU AVIARP59175_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59175_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5272
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×