SERPINF2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the serpin family of serine protease inhibitors. The protein is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in this gene result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINF2

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: CSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Alpha-2-antiplasmin

Protein Size: 491

Purification: Affinity Purified

• SKU: AVIARP59189_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59189_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 5345
• Host: Rabbit