SERPINI1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in t

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINI1

Key Reference: Goedert,M., (2007) Neurology 69 (1), 79-83

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neuroserpin

Protein Size: 410

Purification: Affinity Purified

• SKU: AVIARP56616_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56616_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5274
• Host: Rabbit