SERPINI1 Antibody - middle region : FITC

SERPINI1 Antibody - middle region : FITC
SKU
AVIARP56616_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in t

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINI1

Key Reference: Goedert,M., (2007) Neurology 69 (1), 79-83

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neuroserpin

Protein Size: 410

Purification: Affinity Purified
More Information
SKU AVIARP56616_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56616_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5274
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×