SESN1 Antibody - middle region : Biotin

SESN1 Antibody - middle region : Biotin
SKU
AVIARP55059_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the sestrin family. Sestrins are induced by the p53 tumor suppressor protein and play a role in the cellular response to DNA damage and oxidative stress. The encoded protein mediates p53 inhibition of cell growth by activating AMP-activated protein kinase, which results in the inhibition of the mammalian target of rapamycin protein. The encoded protein also plays a critical role in antioxidant defense by regenerating overoxidized peroxiredoxins, and the expression of this gene is a potential marker for exposure to radiation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SESN1

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: KWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sestrin-1

Protein Size: 551

Purification: Affinity Purified
More Information
SKU AVIARP55059_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55059_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27244
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×