SFN Antibody - N-terminal region : HRP

SFN Antibody - N-terminal region : HRP
SKU
AVIARP54791_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SFN

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: VVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 14-3-3 protein sigma

Protein Size: 248

Purification: Affinity Purified
More Information
SKU AVIARP54791_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54791_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2810
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×