SFRS12IP1 Antibody - N-terminal region : Biotin

SFRS12IP1 Antibody - N-terminal region : Biotin
SKU
AVIARP55718_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SFRS12IP1 is a possible splicing regulator involved in the control of cellular survival.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SFRS12IP1

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: GYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SREK1IP1

Protein Size: 155

Purification: Affinity Purified
More Information
SKU AVIARP55718_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55718_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285672
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×