SFRS12IP1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SFRS12IP1 is a possible splicing regulator involved in the control of cellular survival.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SFRS12IP1

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: GYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein SREK1IP1

Protein Size: 155

Purification: Affinity Purified

• SKU: AVIARP55718_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55718_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 285672
• Host: Rabbit