SGK1 Antibody - N-terminal region : Biotin

SGK1 Antibody - N-terminal region : Biotin
SKU
AVIARP56652_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell sur

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SGK1

Key Reference: Pew,T., (2008) Endocrinology 149 (5), 2637-2645

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase Sgk1

Protein Size: 431

Purification: Affinity Purified
More Information
SKU AVIARP56652_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56652_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 6446
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×