SH3BP4 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3BP4

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: FTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SH3 domain-binding protein 4

Protein Size: 963

Purification: Affinity Purified

• SKU: AVIARP55075_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55075_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23677
• Host: Rabbit