SH3GL2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SH3GL2

Key Reference: Sinha,S., (2008) Ann. Surg. Oncol. 15 (4), 1070-1080

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endophilin-A1

Protein Size: 352

Purification: Affinity Purified

• SKU: AVIARP56550_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56550_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 6456
• Host: Rabbit