Sh3glb1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Sh3glb1 may be required for normal outer mitochondrial membrane dynamics. It is required for coatomer-mediated retrograde transport in certain cells. It may recruit other proteins to membranes with high curvature. It may promote membrane fusion.

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: KIMKQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Endophilin-B1

Protein Size: 365

Purification: Affinity Purified

• SKU: AVIARP58875_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58875_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54673
• Host: Rabbit
• Conjugate: Conjugated, HRP