Sh3kbp1 Antibody - C-terminal region : Biotin

Sh3kbp1 Antibody - C-terminal region : Biotin
SKU
AVIARP54454_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Sh3kbp1 binds apoptosis-linked gene 2 (ALG-2) interacting protein 1; involved in regulation of apoptosis in astrocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Sh3kbp1

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: QSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGIDVSKKTSRTVTISQVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SH3-domain kinase binding protein 1 EMBL AAH70877.1

Protein Size: 665

Purification: Affinity Purified
More Information
SKU AVIARP54454_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54454_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 84357
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×