SH3KBP1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes an adapter protein that contains three N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3KBP1

Molecular Weight: 68

Peptide Sequence: Synthetic peptide located within the following region: TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SH3 domain-containing kinase-binding protein 1

Protein Size: 628

Purification: Affinity Purified

• SKU: AVIARP54453_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54453_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 30011
• Host: Rabbit