SHB Antibody - N-terminal region : Biotin

SHB Antibody - N-terminal region : Biotin
SKU
AVIARP58762_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a rol

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SHB

Key Reference: Kriz,V., (2006) J. Biol. Chem. 281 (45), 34484-34491

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SH2 domain-containing adapter protein B

Protein Size: 509

Purification: Affinity Purified
More Information
SKU AVIARP58762_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58762_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6461
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×