SHB Antibody - N-terminal region : HRP

SHB Antibody - N-terminal region : HRP
SKU
AVIARP58763_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. SHB may also regulate IRS1 and IRS2 signaling in insulin-producing cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SHB

Key Reference: Kriz,V., (2006) J. Biol. Chem. 281 (45), 34484-34491

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SH2 domain-containing adapter protein B

Protein Size: 509

Purification: Affinity Purified
More Information
SKU AVIARP58763_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58763_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6461
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×