SHC3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SHC3 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. SHC3 is involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SHC3

Key Reference: Villanacci,V., (2008) Neurogastroenterol. Motil. 20 (3), 206-212

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SHC-transforming protein 3

Protein Size: 594

Purification: Affinity Purified

• SKU: AVIARP56958_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56958_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 53358
• Host: Rabbit