SHOX2 Antibody - middle region : Biotin

SHOX2 Antibody - middle region : Biotin
SKU
AVIARP58069_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SHOX2 is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing has been observed at this locus and two variants, each encoding a distinct isoform, have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SHOX2

Key Reference: Hillman,R.T., Genome Biol. 5 (2), R8 (2004)

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: PGSPRLTEVSPELKDRKEDAKGMEDEGQTKIKQRRSRTNFTLEQLNELER

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Short stature homeobox protein 2

Protein Size: 331

Purification: Affinity Purified
More Information
SKU AVIARP58069_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58069_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6474
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×