SLIT1 Antibody - middle region : Biotin

SLIT1 Antibody - middle region : Biotin
SKU
AVIARP58765_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SLIT1 is thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors. During neural development involved in axonal navigation at the ventral midline of the neural tub

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLIT1

Key Reference: Hussain,S.A., (2006) J. Biol. Chem. 281 (51), 39693-39698

Molecular Weight: 168kDa

Peptide Sequence: Synthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Slit homolog 1 protein

Protein Size: 1534

Purification: Affinity Purified
More Information
SKU AVIARP58765_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58765_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 6585
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×