SLIT1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SLIT1 is thought to act as molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors. During neural development involved in axonal navigation at the ventral midline of the neural tub

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLIT1

Key Reference: Hussain,S.A., (2006) J. Biol. Chem. 281 (51), 39693-39698

Molecular Weight: 168kDa

Peptide Sequence: Synthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Slit homolog 1 protein

Protein Size: 1534

Purification: Affinity Purified

• SKU: AVIARP58765_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58765_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 6585
• Host: Rabbit
• Conjugate: Conjugated, HRP