Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 1375-1511
Amino Acid Sequence: MHHHHHHKLSPNPPKLTKQMNAIIDTVINYKDRCNVEKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEE
Applications: Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.
Description: Human Bromodomain SMARCA2, also known as BRM, GenBank Accession No. NM_003070, a.a. 1375 - 1511 corresponding to single bromodomain with N-terminal His-tag, MW = 16.9 kDa, expressed in an E. coli expression system.
Format: Aqueous buffer solution
Formulation: 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04 % Tween-20, 20% glycerol
Genbank: NM_003070
Storage Stability: At least 6 months at -80°C.
Tags: N-terminal His-tag
Uniprot: P51531
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Shain, A.H., et al., Proc Natl Acad Sci USA. 2012 Jan 31; 109(5): E252-9.
2. Liu, G., et al., Oncogene. 2011 Jul 21; 30(29): 3295-304
English
Deutsch
