SMG5 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SMG5 plays a role in nonsense-mediated mRNA decay. SMG5 does not have RNase activity by itself. SMG5 promotes dephosphorylation of RENT1. SMG5 is necessary for TERT activity.SMG5 is involved in nonsense-mediated mRNA decay (Ohnishi et al., 2003 [PubMed 14636577]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMG5

Key Reference: Glavan,F., (2006) EMBO J. 25 (21), 5117-5125

Molecular Weight: 114kDa

Peptide Sequence: Synthetic peptide located within the following region: MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SMG5

Protein Size: 1016

Purification: Affinity Purified

• SKU: AVIARP55229_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55229_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23381
• Host: Rabbit