SMUG1 Antibody - middle region : FITC

SMUG1 Antibody - middle region : FITC
SKU
AVIARP55013_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SMUG1

Key Reference: Bethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Single-strand selective monofunctional uracil DNA glycosylase

Protein Size: 270

Purification: Affinity Purified
More Information
SKU AVIARP55013_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55013_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23583
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×