SNAPC5 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: SNAPC5 is the part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. SNAPC5 binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNAPC5

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: KEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: snRNA-activating protein complex subunit 5

Protein Size: 98

Purification: Affinity Purified

Subunit: 5

• SKU: AVIARP57932_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57932_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10302
• Host: Rabbit