SND1-IT1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SNIT1

Key Reference: N/A

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: LRNSCLIRMDLLYWQFTIYTITFCFSHLSGRLTLSAQHISHRPCLLSYSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 110

Purification: Affinity purified

• SKU: AVIARP55045_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55045_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 27099
• Host: Rabbit