SNF8 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNF8

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: DHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar-sorting protein SNF8

Protein Size: 258

Purification: Affinity Purified

• SKU: AVIARP57950_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57950_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 11267
• Host: Rabbit