SNF8 Antibody - middle region : HRP

SNF8 Antibody - middle region : HRP
SKU
AVIARP57950_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNF8

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: DHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Vacuolar-sorting protein SNF8

Protein Size: 258

Purification: Affinity Purified
More Information
SKU AVIARP57950_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57950_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 11267
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×