Sntg1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Sntg1 is an adapter protein that binds to and probably organizes the subcellular localization of a variety of proteins. It may link various receptors to the actin cytoskeleton and the dystrophin glycoprotein complex. It may participate in regulating the subcellular location of diacylglycerol kinase-zeta to ensure that diacylglycerol is rapidly inactivated following receptor activation.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: KLPVNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gamma-1-syntrophin

Protein Size: 517

Purification: Affinity Purified

• SKU: AVIARP57299_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57299_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 71096
• Host: Rabbit