Sntg1 Antibody - N-terminal region : HRP

Sntg1 Antibody - N-terminal region : HRP
SKU
AVIARP57299_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Sntg1 is an adapter protein that binds to and probably organizes the subcellular localization of a variety of proteins. It may link various receptors to the actin cytoskeleton and the dystrophin glycoprotein complex. It may participate in regulating the subcellular location of diacylglycerol kinase-zeta to ensure that diacylglycerol is rapidly inactivated following receptor activation.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: KLPVNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Gamma-1-syntrophin

Protein Size: 517

Purification: Affinity Purified
More Information
SKU AVIARP57299_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57299_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 71096
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×