SNX11 Antibody - middle region : Biotin

SNX11 Antibody - middle region : Biotin
SKU
AVIARP55482_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. This gene results in two transcript variants differing in the 5' UTR, but encoding the same protein.

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: GTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sorting nexin-11

Protein Size: 270

Purification: Affinity Purified
More Information
SKU AVIARP55482_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55482_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29916
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×