SNX5 Antibody - N-terminal region : HRP

SNX5 Antibody - N-terminal region : HRP
SKU
AVIARP55050_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SNX5 is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein binds to fanconi anemia complementation group A protein, but its function is unknown.This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein binds to fanconi anemia complementation group A protein, but its function is unknown. This gene results in two transcript variants encoding the same protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNX5

Key Reference: Wassmer,T., J. Cell. Sci. 120 (PT 1), 45-54 (2007)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sorting nexin-5

Protein Size: 404

Purification: Affinity Purified
More Information
SKU AVIARP55050_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55050_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27131
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×