SNX7 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region like s

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNX7

Key Reference: Dateki,M., (2005) J. Biol. Chem. 280 (21), 20503-20508

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sorting nexin-7

Protein Size: 387

Purification: Affinity Purified

• SKU: AVIARP56795_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56795_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51375
• Host: Rabbit