SPATA16 Antibody - N-terminal region : Biotin

SPATA16 Antibody - N-terminal region : Biotin
SKU
AVIARP58663_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SPATA16 is involved in the formation of sperm acrosome, which implicated its potential role in spermatogenesis and sperm-egg fusion. Defects in SPATA16 are a cause of globozoospermia; also called Round-headed spermatozoa.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPATA16

Key Reference: Dam,A.H., (2007) Am. J. Hum. Genet. 81 (4), 813-820

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: MDAGSSRSLENAVNRIYHDQLVPKINTSKKMSTLAHPPNILEMSQEIKKN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spermatogenesis-associated protein 16

Protein Size: 569

Purification: Affinity Purified
More Information
SKU AVIARP58663_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58663_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 83893
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×