SPATA7 Antibody - middle region : FITC

SPATA7 Antibody - middle region : FITC
SKU
AVIARP57243_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of the SPATA7 protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPATA7

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spermatogenesis-associated protein 7

Protein Size: 599

Purification: Affinity Purified
More Information
SKU AVIARP57243_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57243_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55812
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×