SPDYA Antibody - middle region : HRP

SPDYA Antibody - middle region : HRP
SKU
AVIARP55846_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPDYA

Key Reference: McAndrew,C.W., (2007) Cell Cycle 6 (15), 1937-1945

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: HTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Speedy protein A

Protein Size: 313

Purification: Affinity Purified
More Information
SKU AVIARP55846_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55846_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 245711
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×