SPDYA Antibody - N-terminal region : FITC

SPDYA Antibody - N-terminal region : FITC
SKU
AVIARP55845_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPDYA

Key Reference: McAndrew,C.W., (2007) Cell Cycle 6 (15), 1937-1945

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Speedy protein A

Protein Size: 313

Purification: Affinity Purified
More Information
SKU AVIARP55845_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55845_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 245711
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×