SPINK6 Antibody - middle region : HRP

SPINK6 Antibody - middle region : HRP
SKU
AVIARP55978_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a Kazal-type serine protease inhibitor that acts on kallikrein-related peptidases in the skin. Two transcript variants the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPINK6

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: GEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine protease inhibitor Kazal-type 6

Protein Size: 80

Purification: Affinity Purified
More Information
SKU AVIARP55978_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55978_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 404203
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×